PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000293456
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 477aa    MW: 52536.7 Da    PI: 8.8443
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000293456genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY81.96.6e-26159215259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +DgynWrKYGqK+vk+ + +rsYYrCt+++C +kk +er+++ ++v+ei+Y+++H+h+
  MDP0000293456 159 SDGYNWRKYGQKQVKSPQGSRSYYRCTFSECYAKK-IERCDHSGHVTEIVYKSQHTHD 215
                    7********************************98.*********************7 PP

2WRKY98.54.2e-31340396359
                    -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ ++ ++v+itY+g H+he
  MDP0000293456 340 DGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKQIETAVDNSSAVIITYKGVHDHE 396
                    9*******************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182901.96E-20156217IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.9E-21156217IPR003657WRKY domain
SMARTSM007743.3E-25158216IPR003657WRKY domain
PROSITE profilePS5081118.418159217IPR003657WRKY domain
PfamPF031062.6E-18160215IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.4E-32323398IPR003657WRKY domain
PROSITE profilePS5081131.1333398IPR003657WRKY domain
SuperFamilySSF1182902.48E-27334398IPR003657WRKY domain
SMARTSM007749.4E-36338397IPR003657WRKY domain
PfamPF031064.0E-24340395IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MAEHRESSHA LPAEKLQPRK QEQKEGGDGD EXEKQRLGKF QXGELESSVS ELRQTRLETP  60
TAPSTLEVSG NDQFAGLQLE SVSQSIDGAG LQEQLGLSHQ ENLASVANHK TPKQSQTQLT  120
VYPTPFSELS PTSVTQSISS APSPIPLERR VPHGKTSASD GYNWRKYGQK QVKSPQGSRS  180
YYRCTFSECY AKKIERCDHS GHVTEIVYKS QHTHDPPRKS ICIKESKLAL SAECVRYRVA  240
AAEHSCRIVN DSEXSTSSKE PIXETPSIPE RKRQSSSDSD DNGDVKIKEE HGDGDEPEPK  300
RRQVYVMKKS NSKYSASLSK PGKKPKLVVH AAGDVGISGD GYRWRKYGQK MVKGNPHPRN  360
YYRCTSAGCP VRKQIETAVD NSSAVIITYK GVHDHEMPVP KKRHGPPSAP LVAAAAPASM  420
NNLHIKKTDT DPKPISPTQW SVDTGGELTR EALDLGGEKA MESARTLLSI GFEIKPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A3e-24326398274WRKY transcription factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.232720.0bud| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008384382.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595831e-126WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLM5W7R30.0M5W7R3_PRUPE; Uncharacterized protein
STRINGVIT_11s0037g00150.t011e-171(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51983456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-116WRKY DNA-binding protein 32